An example GenBank record, elements bolded for clarity.

LOCUS HFL141 3385 bp DNA VRT 02-FEB-1995
DEFINITION H.fransciscii 141 gene for immunoglobulin lambda light chain.
ACCESSION X15315 X17646
NID g63972
KEYWORDS Ig light chain; immunoglobulin.
SOURCE horn shark.
ORGANISM Heterodontus francisci
Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata;
Vertebrata; Chondrichthyes; Elasmobranchii; Heterodontiformes;
Heterodontidae; Heterodontus.
REFERENCE 1 (bases 1 to 3385)
AUTHORS Litman,G.W.
TITLE Direct Submission
JOURNAL Submitted (18-MAY-1989) Litman G.W., Showa Research Institute,
10900 Roosevelt Blvd, St Petersburg, fl 33716, USA
REFERENCE 2 (bases 256 to 3385)
AUTHORS Shamblott,M.J. and Litman,G.W.
TITLE Genomic organization and sequences of immunoglobulin light chain
genes in a primitive vertebrate suggest coevolution of
immunoglobulin gene organization
JOURNAL EMBO J. 8 (12), 3733-3739 (1989)
MEDLINE 90059974
COMMENT See also .
FEATURES Location/Qualifiers
source 1..3385
/organism="Heterodontus francisci"
/db_xref="taxon:7792"
/dev_stage="germ line"
/tissue_type="liver"
/clone_lib="lambda-DASH"
misc_feature 300..307
/note="regulatory octamer"
V_region 442..478
/product="variable region of Ig lambda light chain"
CDS join(442..478,630..955,1340..1376,2708..3036)
/codon_start=1
/product="lambda light chain of immunoglobulin"
/db_xref="PID:g642236"
/translation="MYLLGTLLLHLTGVLAVPVLNQTPISDPVSAGETSELKCAMQNG
NVGSYYMSWYRQRPGEAPVFVLYQSTSGSIYRGTGFTDRFKPSRDTSSNSHILTIGSL
EPGDSAVYYCAANDGSAATFTFGPGTALSLRSSEDRKPSVLLLPPSSEEIDSGWATLS
CLVSRFKPGFVRVLWRVDDKETDSGVTTGTVSTDSDQSYSLSSYLRVPATAWNKGSSY
TCSVDHGSLSSPLLKTISSTACSD"
intron 479..629
V_region 630..955
/product="variable region of Ig lambda light chain"
intron 956..1339
J_segment 1340..1376
/product="joining region of Ig lambda light chain"
intron 1377..2707
C_region 2708..3036
/product="constant region of Ig lambda light chain"
polyA_signal 3366..3371
BASE COUNT 890 a 807 c 720 g 968 t
ORIGIN
1 gaatttaagg cactggattc tgaagggctt ttgtttttgt ccatctggga taaaatgtgc
61 aatttctaca gttgttcttt taaatctcac actcttgaca tgagaagggg gggttaaaat
121 cagaaattat tgtgaattaa ccctcaactc ggtggaaata aatacatgga aatgtttaat
...deleted to save space....
3301 tcctttctct cagtagtacc atttgttaga attgaaaagt gtatctctct gtgtgtggct
3361 gttttaataa agatgacatg aattc
//